PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0099200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family HD-ZIP
Protein Properties Length: 844aa    MW: 90365.9 Da    PI: 6.3726
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0099200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.28.9e-21139194156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++eLe+lF+++++p++++r eL+kkl L+ rqVk+WFqNrR+++k
  Spipo1G0099200 139 KKRYHRHTPWQIQELEALFKECPHPDEKQRLELSKKLALDSRQVKFWFQNRRTQMK 194
                     688999***********************************************999 PP

2START187.28.8e-593505732206
                     HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la++a++elvk+a+ eep+W +++   e +n++e+++  +           + +ea r++g+v+ ++  lve+l+d k +W e+++    k + +
  Spipo1G0099200 350 LALAAMDELVKMAQMEEPLWIRDVsgrEVLNSEEYVRVSSH--ClgskpvgFVTEATRETGIVIINSSALVETLMDGK-RWPEMFPsmiaKTSPT 441
                     6899********************88888888888877743..355888999**************************.*******665555666 PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                     +vi  g      g+lqlm aelq+lsplvp R++ f+Ry++++ +g+w++vdvSv++ +  +   +++v +++lpSg+l+++++ng+skvtwveh
  Spipo1G0099200 442 DVIYMGmggtrnGTLQLMRAELQVLSPLVPiREVNFLRYCKEHAQGVWAVVDVSVEPITGGSPgLHPSVSCRRLPSGCLVQDMPNGYSKVTWVEH 536
                     666666*******************************************************9999****************************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++++ +h l+r+l++sg+a ga++wvatlqrqce+
  Spipo1G0099200 537 AEYDESGVHLLYRPLLRSGMALGAQRWVATLQRQCEC 573
                     ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-20123196IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-21123190IPR009057Homeodomain-like
PROSITE profilePS5007117.054136196IPR001356Homeobox domain
SMARTSM003894.3E-18137200IPR001356Homeobox domain
PfamPF000462.9E-18139194IPR001356Homeobox domain
CDDcd000863.29E-18139196No hitNo description
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PROSITE profilePS5084840.849340576IPR002913START domain
SuperFamilySSF559616.28E-31342573No hitNo description
CDDcd088751.82E-111344572No hitNo description
SMARTSM002341.6E-43349573IPR002913START domain
PfamPF018521.0E-51350573IPR002913START domain
SuperFamilySSF559611.19E-20603835No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MSFGGFLDSS SAGATVVVDI PYSSTTAGMP AGVMSQPRLL SPSLPKSIFS SPSLSLALQT  60
NLEGGGVGGA SGGHNEMLRQ IAGVGDFDSP GGGGFIAGAG FAGKSNGGQR EDENESRSGS  120
DNMEGGSGDD NDPENPPKKK RYHRHTPWQI QELEALFKEC PHPDEKQRLE LSKKLALDSR  180
QVKFWFQNRR TQMKTQLERH ENALLRQENE KLKMENMHIR ESMRNPMCQN CGGAATLGQV  240
SMEQQQLRLE NARLRDELDR VTALAGRFIG RPIGSFAGQL SHMPDSSLEL AVGGNGFAGL  300
CPVPSALPPV TDYVTGISSG MPVVTPSSVR PVAPVGEVDR SFERSMLVDL ALAAMDELVK  360
MAQMEEPLWI RDVSGREVLN SEEYVRVSSH CLGSKPVGFV TEATRETGIV IINSSALVET  420
LMDGKRWPEM FPSMIAKTSP TDVIYMGMGG TRNGTLQLMR AELQVLSPLV PIREVNFLRY  480
CKEHAQGVWA VVDVSVEPIT GGSPGLHPSV SCRRLPSGCL VQDMPNGYSK VTWVEHAEYD  540
ESGVHLLYRP LLRSGMALGA QRWVATLQRQ CECLAVLMSS VLSNRELPMT GITAAGRRSM  600
LKLAQRMTAN FCAGVCASSV HSWAKLNIGA VGEDVRVMTR KSENDPGEPP GVVLSAATSV  660
WLPSAPQRVF DFLRNASLRS EWDILSNGGP MQEMAHIAKG QDQGNAVSLL RASAGGTNQS  720
SMLILQETCT DASGSLVVYA PVDIPAMHLV MNGGDSSCVA LLPSGFAISP DGPDMRGSQQ  780
QSHNAGGNSS PPSAAGGSLL TVAFQILVNS LPTAKLTVES VETVNNLISC TVKKIKVALH  840
CDN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661562.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLF6I3160.0F6I316_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1